PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_17018.1_g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family NAC
Protein Properties Length: 324aa    MW: 37638.2 Da    PI: 9.1523
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_17018.1_g00001.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM61.52.8e-1925630678128
                      NAM  78 tksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              + +gyWkatg +++++  k+ +vg++k Lv+y g+apkg+kt+W+mheyrl
  Sme2.5_17018.1_g00001.1 256 AGNGYWKATGANRDIKYDKNVTVGVRKALVYYYGKAPKGQKTNWIMHEYRL 306
                              568**************9*******************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF139611.3E-81339IPR025314Domain of unknown function DUF4219
PfamPF142237.5E-963116No hitNo description
PROSITE profilePS5100517.544176324IPR003441NAC domain
PfamPF023651.3E-9254306IPR003441NAC domain
SuperFamilySSF1019412.09E-19254308IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MNFETSFLTP PVFNGENYQA WTIRMSVHLE ALDLWEAVEE DYEVAPLGDN PTINQIKNHR  60
EDKTRKAKAK DCLFSAVSLS ILTRIMQMKS AAEIWEYLKK EYQENEKVQN IQALEQRRMM  120
RKEGSVEGAF QPKLENKSNK GWKINKKLRP SHVERVCKSQ LQQKEAKNLL SVEQLLENSL  180
KLLFEEKACL VKDADNKEMF KIKMKGRSFN LNLFDEKQKI LEFLDEDVHN VPIKGTRTLF  240
DIYQRCDVAV LEPESAGNGY WKATGANRDI KYDKNVTVGV RKALVYYYGK APKGQKTNWI  300
MHEYRLPGVP DISQRGPKDL KLDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-1525530690140Stress-induced transcription factor NAC1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2430401e-121AC243040.1 Solanum tuberosum chromosome 11 clone RH142N14, complete sequence.
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.18e-20NAC family protein